Anti CSPG5 pAb (ATL-HPA067818)

Atlas Antibodies

SKU:
ATL-HPA067818-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chondroitin sulfate proteoglycan 5 (neuroglycan C)
Gene Name: CSPG5
Alternative Gene Name: NGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032482: 77%, ENSRNOG00000020833: 82%
Entrez Gene ID: 10675
Uniprot ID: O95196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGVTAKAGSGDAQALPATLQAPHEVLGQSIMPPAIPEATEASGPPSPTPGDKLSPASELPKESPLEVWLNL
Gene Sequence GGVTAKAGSGDAQALPATLQAPHEVLGQSIMPPAIPEATEASGPPSPTPGDKLSPASELPKESPLEVWLNL
Gene ID - Mouse ENSMUSG00000032482
Gene ID - Rat ENSRNOG00000020833
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CSPG5 pAb (ATL-HPA067818)
Datasheet Anti CSPG5 pAb (ATL-HPA067818) Datasheet (External Link)
Vendor Page Anti CSPG5 pAb (ATL-HPA067818) at Atlas Antibodies

Documents & Links for Anti CSPG5 pAb (ATL-HPA067818)
Datasheet Anti CSPG5 pAb (ATL-HPA067818) Datasheet (External Link)
Vendor Page Anti CSPG5 pAb (ATL-HPA067818)