Anti CSNK2A2 pAb (ATL-HPA077719)

Atlas Antibodies

SKU:
ATL-HPA077719-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: casein kinase 2, alpha prime polypeptide
Gene Name: CSNK2A2
Alternative Gene Name: CSNK2A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046707: 94%, ENSRNOG00000011933: 94%
Entrez Gene ID: 1459
Uniprot ID: P19784
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Gene Sequence EAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Gene ID - Mouse ENSMUSG00000046707
Gene ID - Rat ENSRNOG00000011933
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CSNK2A2 pAb (ATL-HPA077719)
Datasheet Anti CSNK2A2 pAb (ATL-HPA077719) Datasheet (External Link)
Vendor Page Anti CSNK2A2 pAb (ATL-HPA077719) at Atlas Antibodies

Documents & Links for Anti CSNK2A2 pAb (ATL-HPA077719)
Datasheet Anti CSNK2A2 pAb (ATL-HPA077719) Datasheet (External Link)
Vendor Page Anti CSNK2A2 pAb (ATL-HPA077719)