Anti CSNK2A2 pAb (ATL-HPA077719)
Atlas Antibodies
- SKU:
- ATL-HPA077719-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CSNK2A2
Alternative Gene Name: CSNK2A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046707: 94%, ENSRNOG00000011933: 94%
Entrez Gene ID: 1459
Uniprot ID: P19784
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
Gene Sequence | EAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
Gene ID - Mouse | ENSMUSG00000046707 |
Gene ID - Rat | ENSRNOG00000011933 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CSNK2A2 pAb (ATL-HPA077719) | |
Datasheet | Anti CSNK2A2 pAb (ATL-HPA077719) Datasheet (External Link) |
Vendor Page | Anti CSNK2A2 pAb (ATL-HPA077719) at Atlas Antibodies |
Documents & Links for Anti CSNK2A2 pAb (ATL-HPA077719) | |
Datasheet | Anti CSNK2A2 pAb (ATL-HPA077719) Datasheet (External Link) |
Vendor Page | Anti CSNK2A2 pAb (ATL-HPA077719) |