Anti CSNK2A2 pAb (ATL-HPA077719)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077719-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CSNK2A2
Alternative Gene Name: CSNK2A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046707: 94%, ENSRNOG00000011933: 94%
Entrez Gene ID: 1459
Uniprot ID: P19784
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
| Gene Sequence | EAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
| Gene ID - Mouse | ENSMUSG00000046707 |
| Gene ID - Rat | ENSRNOG00000011933 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CSNK2A2 pAb (ATL-HPA077719) | |
| Datasheet | Anti CSNK2A2 pAb (ATL-HPA077719) Datasheet (External Link) |
| Vendor Page | Anti CSNK2A2 pAb (ATL-HPA077719) at Atlas Antibodies |
| Documents & Links for Anti CSNK2A2 pAb (ATL-HPA077719) | |
| Datasheet | Anti CSNK2A2 pAb (ATL-HPA077719) Datasheet (External Link) |
| Vendor Page | Anti CSNK2A2 pAb (ATL-HPA077719) |