Anti CSNK1E pAb (ATL-HPA026288)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026288-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: CSNK1E
Alternative Gene Name: CKIE, CKIepsilon, HCKIE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022433: 97%, ENSRNOG00000013076: 99%
Entrez Gene ID: 1454
Uniprot ID: P49674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAGNTSP |
Gene Sequence | NMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAGNTSP |
Gene ID - Mouse | ENSMUSG00000022433 |
Gene ID - Rat | ENSRNOG00000013076 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CSNK1E pAb (ATL-HPA026288) | |
Datasheet | Anti CSNK1E pAb (ATL-HPA026288) Datasheet (External Link) |
Vendor Page | Anti CSNK1E pAb (ATL-HPA026288) at Atlas Antibodies |
Documents & Links for Anti CSNK1E pAb (ATL-HPA026288) | |
Datasheet | Anti CSNK1E pAb (ATL-HPA026288) Datasheet (External Link) |
Vendor Page | Anti CSNK1E pAb (ATL-HPA026288) |
Citations for Anti CSNK1E pAb (ATL-HPA026288) – 6 Found |
Kuga, Takahisa; Sasaki, Mitsuho; Mikami, Toshinari; Miake, Yasuo; Adachi, Jun; Shimizu, Maiko; Saito, Youhei; Koura, Minako; Takeda, Yasunori; Matsuda, Junichiro; Tomonaga, Takeshi; Nakayama, Yuji. FAM83H and casein kinase I regulate the organization of the keratin cytoskeleton and formation of desmosomes. Scientific Reports. 2016;6( 27222304):26557. PubMed |
Fulcher, Luke J; Bozatzi, Polyxeni; Tachie-Menson, Theresa; Wu, Kevin Z L; Cummins, Timothy D; Bufton, Joshua C; Pinkas, Daniel M; Dunbar, Karen; Shrestha, Sabin; Wood, Nicola T; Weidlich, Simone; Macartney, Thomas J; Varghese, Joby; Gourlay, Robert; Campbell, David G; Dingwell, Kevin S; Smith, James C; Bullock, Alex N; Sapkota, Gopal P. The DUF1669 domain of FAM83 family proteins anchor casein kinase 1 isoforms. Science Signaling. 2018;11(531) PubMed |
Kuga, Takahisa; Kume, Hideaki; Adachi, Jun; Kawasaki, Naoko; Shimizu, Maiko; Hoshino, Isamu; Matsubara, Hisahiro; Saito, Youhei; Nakayama, Yuji; Tomonaga, Takeshi. Casein kinase 1 is recruited to nuclear speckles by FAM83H and SON. Scientific Reports. 2016;6( 27681590):34472. PubMed |
Fulcher, Luke J; He, Zhengcheng; Mei, Lin; Macartney, Thomas J; Wood, Nicola T; Prescott, Alan R; Whigham, Arlene J; Varghese, Joby; Gourlay, Robert; Ball, Graeme; Clarke, Rosemary; Campbell, David G; Maxwell, Christopher A; Sapkota, Gopal P. FAM83D directs protein kinase CK1α to the mitotic spindle for proper spindle positioning. Embo Reports. 2019;20(9):e47495. PubMed |
Wu, Kevin Z L; Jones, Rebecca A; Tachie-Menson, Theresa; Macartney, Thomas J; Wood, Nicola T; Varghese, Joby; Gourlay, Robert; Soares, Renata F; Smith, James C; Sapkota, Gopal P. Pathogenic FAM83G palmoplantar keratoderma mutations inhibit the PAWS1:CK1α association and attenuate Wnt signalling. Wellcome Open Research. 4( 31656861):133. PubMed |
Tachie-Menson, Theresa; Gázquez-Gutiérrez, Ana; Fulcher, Luke J; Macartney, Thomas J; Wood, Nicola T; Varghese, Joby; Gourlay, Robert; Soares, Renata F; Sapkota, Gopal P. Characterisation of the biochemical and cellular roles of native and pathogenic amelogenesis imperfecta mutants of FAM83H. Cellular Signalling. 2020;72( 32289446):109632. PubMed |