Anti CSNK1A1 pAb (ATL-HPA051334)

Atlas Antibodies

Catalog No.: ATL-HPA051334-25

Protein Description: casein kinase 1, alpha 1
Gene Name: CSNK1A1
Alternative Gene Name: CK1, CK1a, CK1alpha, CKIa, CKIalpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024576: 100%, ENSRNOG00000017106: 100%
Entrez Gene ID: 1452
Uniprot ID: P48729
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQT
• Gene Sequence: TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQT
• Gene ID - Mouse: ENSMUSG00000024576
• Gene ID - Rat: ENSRNOG00000017106
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.