Anti CSNK1A1 pAb (ATL-HPA051334)

Atlas Antibodies

Catalog No.:
ATL-HPA051334-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: casein kinase 1, alpha 1
Gene Name: CSNK1A1
Alternative Gene Name: CK1, CK1a, CK1alpha, CKIa, CKIalpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024576: 100%, ENSRNOG00000017106: 100%
Entrez Gene ID: 1452
Uniprot ID: P48729
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQT
Gene Sequence TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQT
Gene ID - Mouse ENSMUSG00000024576
Gene ID - Rat ENSRNOG00000017106
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CSNK1A1 pAb (ATL-HPA051334)
Datasheet Anti CSNK1A1 pAb (ATL-HPA051334) Datasheet (External Link)
Vendor Page Anti CSNK1A1 pAb (ATL-HPA051334) at Atlas Antibodies

Documents & Links for Anti CSNK1A1 pAb (ATL-HPA051334)
Datasheet Anti CSNK1A1 pAb (ATL-HPA051334) Datasheet (External Link)
Vendor Page Anti CSNK1A1 pAb (ATL-HPA051334)