Anti CSN3 pAb (ATL-HPA035953 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA035953-25
  • Immunohistochemical staining of human colon, lactating breast, liver and testis using Anti-CSN3 antibody HPA035953 (A) shows similar protein distribution across tissues to independent antibody HPA035954 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: casein kappa
Gene Name: CSN3
Alternative Gene Name: CSN10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001622: 34%, ENSRNOG00000001951: 40%
Entrez Gene ID: 1448
Uniprot ID: P07498
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIIIPTINTIATVEPTPA
Gene Sequence PAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIIIPTINTIATVEPTPA
Gene ID - Mouse ENSMUSG00000001622
Gene ID - Rat ENSRNOG00000001951
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CSN3 pAb (ATL-HPA035953 w/enhanced validation)
Datasheet Anti CSN3 pAb (ATL-HPA035953 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CSN3 pAb (ATL-HPA035953 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CSN3 pAb (ATL-HPA035953 w/enhanced validation)
Datasheet Anti CSN3 pAb (ATL-HPA035953 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CSN3 pAb (ATL-HPA035953 w/enhanced validation)