Anti CSN2 pAb (ATL-HPA041036)

Atlas Antibodies

Catalog No.:
ATL-HPA041036-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: casein beta
Gene Name: CSN2
Alternative Gene Name: CASB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063157: 42%, ENSRNOG00000039326: 40%
Entrez Gene ID: 1447
Uniprot ID: P05814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVH
Gene Sequence VPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVH
Gene ID - Mouse ENSMUSG00000063157
Gene ID - Rat ENSRNOG00000039326
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CSN2 pAb (ATL-HPA041036)
Datasheet Anti CSN2 pAb (ATL-HPA041036) Datasheet (External Link)
Vendor Page Anti CSN2 pAb (ATL-HPA041036) at Atlas Antibodies

Documents & Links for Anti CSN2 pAb (ATL-HPA041036)
Datasheet Anti CSN2 pAb (ATL-HPA041036) Datasheet (External Link)
Vendor Page Anti CSN2 pAb (ATL-HPA041036)