Anti CSK pAb (ATL-HPA026488)

Atlas Antibodies

Catalog No.:
ATL-HPA026488-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: c-src tyrosine kinase
Gene Name: CSK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032312: 100%, ENSRNOG00000019374: 100%
Entrez Gene ID: 1445
Uniprot ID: P41240
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQ
Gene Sequence QDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQ
Gene ID - Mouse ENSMUSG00000032312
Gene ID - Rat ENSRNOG00000019374
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CSK pAb (ATL-HPA026488)
Datasheet Anti CSK pAb (ATL-HPA026488) Datasheet (External Link)
Vendor Page Anti CSK pAb (ATL-HPA026488) at Atlas Antibodies

Documents & Links for Anti CSK pAb (ATL-HPA026488)
Datasheet Anti CSK pAb (ATL-HPA026488) Datasheet (External Link)
Vendor Page Anti CSK pAb (ATL-HPA026488)