Anti CSH1 pAb (ATL-HPA043715)

Atlas Antibodies

Catalog No.:
ATL-HPA043715-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chorionic somatomammotropin hormone 1 (placental lactogen)
Gene Name: CSH1
Alternative Gene Name: CSA, CSMT, FLJ75407, hCS-A, PL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020713: 60%, ENSRNOG00000011207: 58%
Entrez Gene ID: 1442
Uniprot ID: P0DML2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Gene Sequence SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Gene ID - Mouse ENSMUSG00000020713
Gene ID - Rat ENSRNOG00000011207
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CSH1 pAb (ATL-HPA043715)
Datasheet Anti CSH1 pAb (ATL-HPA043715) Datasheet (External Link)
Vendor Page Anti CSH1 pAb (ATL-HPA043715) at Atlas Antibodies

Documents & Links for Anti CSH1 pAb (ATL-HPA043715)
Datasheet Anti CSH1 pAb (ATL-HPA043715) Datasheet (External Link)
Vendor Page Anti CSH1 pAb (ATL-HPA043715)