Anti CSH1 pAb (ATL-HPA043715)

Atlas Antibodies

Catalog No.: ATL-HPA043715-25

Protein Description: chorionic somatomammotropin hormone 1 (placental lactogen)
Gene Name: CSH1
Alternative Gene Name: CSA, CSMT, FLJ75407, hCS-A, PL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020713: 60%, ENSRNOG00000011207: 58%
Entrez Gene ID: 1442
Uniprot ID: P0DML2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
• Gene Sequence: SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
• Gene ID - Mouse: ENSMUSG00000020713
• Gene ID - Rat: ENSRNOG00000011207
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.