Anti CSF1R pAb (ATL-HPA012323)

Atlas Antibodies

Catalog No.:
ATL-HPA012323-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: colony stimulating factor 1 receptor
Gene Name: CSF1R
Alternative Gene Name: C-FMS, CD115, CSFR, FMS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024621: 58%, ENSRNOG00000018414: 61%
Entrez Gene ID: 1436
Uniprot ID: P07333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP
Gene Sequence NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP
Gene ID - Mouse ENSMUSG00000024621
Gene ID - Rat ENSRNOG00000018414
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CSF1R pAb (ATL-HPA012323)
Datasheet Anti CSF1R pAb (ATL-HPA012323) Datasheet (External Link)
Vendor Page Anti CSF1R pAb (ATL-HPA012323) at Atlas Antibodies

Documents & Links for Anti CSF1R pAb (ATL-HPA012323)
Datasheet Anti CSF1R pAb (ATL-HPA012323) Datasheet (External Link)
Vendor Page Anti CSF1R pAb (ATL-HPA012323)
Citations for Anti CSF1R pAb (ATL-HPA012323) – 4 Found
Pass, Harvey I; Lavilla, Carmencita; Canino, Claudia; Goparaju, Chandra; Preiss, Jordan; Noreen, Samrah; Blandino, Giovanni; Cioce, Mario. Inhibition of the colony-stimulating-factor-1 receptor affects the resistance of lung cancer cells to cisplatin. Oncotarget. 2016;7(35):56408-56421.  PubMed
Baghdadi, Muhammad; Endo, Hiraku; Takano, Atsushi; Ishikawa, Kozo; Kameda, Yosuke; Wada, Haruka; Miyagi, Yohei; Yokose, Tomoyuki; Ito, Hiroyuki; Nakayama, Haruhiko; Daigo, Yataro; Suzuki, Nao; Seino, Ken-Ichiro. High co-expression of IL-34 and M-CSF correlates with tumor progression and poor survival in lung cancers. Scientific Reports. 2018;8(1):418.  PubMed
Wang, Xingchao; Zhang, Jianfeng; Hu, Baoying; Qian, Fei. High Expression of CSF-1R Predicts Poor Prognosis and CSF-1R(high) Tumor-Associated Macrophages Inhibit Anti-Tumor Immunity in Colon Adenocarcinoma. Frontiers In Oncology. 12( 35444953):850767.  PubMed
Shi, Xiaolong; Kaller, Markus; Rokavec, Matjaz; Kirchner, Thomas; Horst, David; Hermeking, Heiko. Characterization of a p53/miR-34a/CSF1R/STAT3 Feedback Loop in Colorectal Cancer. Cellular And Molecular Gastroenterology And Hepatology. 10(2):391-418.  PubMed