Anti CSDE1 pAb (ATL-HPA018846)

Atlas Antibodies

SKU:
ATL-HPA018846-25
  • Immunohistochemical staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
  • Western blot analysis in human cell line MCF-7.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cold shock domain containing E1, RNA-binding
Gene Name: CSDE1
Alternative Gene Name: D1S155E, UNR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068823: 97%, ENSRNOG00000061058: 77%
Entrez Gene ID: 7812
Uniprot ID: O75534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERMNGQEVFYLTYTPEDVEGNVQLETGDKIN
Gene Sequence NLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERMNGQEVFYLTYTPEDVEGNVQLETGDKIN
Gene ID - Mouse ENSMUSG00000068823
Gene ID - Rat ENSRNOG00000061058
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CSDE1 pAb (ATL-HPA018846)
Datasheet Anti CSDE1 pAb (ATL-HPA018846) Datasheet (External Link)
Vendor Page Anti CSDE1 pAb (ATL-HPA018846) at Atlas Antibodies

Documents & Links for Anti CSDE1 pAb (ATL-HPA018846)
Datasheet Anti CSDE1 pAb (ATL-HPA018846) Datasheet (External Link)
Vendor Page Anti CSDE1 pAb (ATL-HPA018846)



Citations for Anti CSDE1 pAb (ATL-HPA018846) – 2 Found
Azzi-Martin, Lamia; He, Wencan; Péré-Védrenne, Christelle; Korolik, Victoria; Alix, Chloé; Prochazkova-Carlotti, Martina; Morel, Jean-Luc; Le Roux-Goglin, Emilie; Lehours, Philippe; Djavaheri-Mergny, Mojgan; Grosset, Christophe F; Varon, Christine; Dubus, Pierre; Ménard, Armelle. Cytolethal distending toxin induces the formation of transient messenger-rich ribonucleoprotein nuclear invaginations in surviving cells. Plos Pathogens. 2019;15(9):e1007921.  PubMed
Guo, Hui; Li, Ying; Shen, Lu; Wang, Tianyun; Jia, Xiangbin; Liu, Lijuan; Xu, Tao; Ou, Mengzhu; Hoekzema, Kendra; Wu, Huidan; Gillentine, Madelyn A; Liu, Cenying; Ni, Hailun; Peng, Pengwei; Zhao, Rongjuan; Zhang, Yu; Phornphutkul, Chanika; Stegmann, Alexander P A; Prada, Carlos E; Hopkin, Robert J; Shieh, Joseph T; McWalter, Kirsty; Monaghan, Kristin G; van Hasselt, Peter M; van Gassen, Koen; Bai, Ting; Long, Min; Han, Lin; Quan, Yingting; Chen, Meilin; Zhang, Yaowen; Li, Kuokuo; Zhang, Qiumeng; Tan, Jieqiong; Zhu, Tengfei; Liu, Yaning; Pang, Nan; Peng, Jing; Scott, Daryl A; Lalani, Seema R; Azamian, Mahshid; Mancini, Grazia M S; Adams, Darius J; Kvarnung, Malin; Lindstrand, Anna; Nordgren, Ann; Pevsner, Jonathan; Osei-Owusu, Ikeoluwa A; Romano, Corrado; Calabrese, Giuseppe; Galesi, Ornella; Gecz, Jozef; Haan, Eric; Ranells, Judith; Racobaldo, Melissa; Nordenskjold, Magnus; Madan-Khetarpal, Suneeta; Sebastian, Jessica; Ball, Susie; Zou, Xiaobing; Zhao, Jingping; Hu, Zhengmao; Xia, Fan; Liu, Pengfei; Rosenfeld, Jill A; de Vries, Bert B A; Bernier, Raphael A; Xu, Zhi-Qing David; Li, Honghui; Xie, Wei; Hufnagel, Robert B; Eichler, Evan E; Xia, Kun. Disruptive variants of CSDE1 associate with autism and interfere with neuronal development and synaptic transmission. Science Advances. 2019;5(9):eaax2166.  PubMed