Anti CRYZL1 pAb (ATL-HPA029399 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA029399-100
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CRYZL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407853).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: crystallin, zeta (quinone reductase)-like 1
Gene Name: CRYZL1
Alternative Gene Name: 4P11, QOH-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058240: 91%, ENSRNOG00000028014: 92%
Entrez Gene ID: 9946
Uniprot ID: O95825
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGSKVSFFQPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGVRAYTALHYLSHLSPGKSVLIMDGASAFGTI
Gene Sequence VGSKVSFFQPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGVRAYTALHYLSHLSPGKSVLIMDGASAFGTI
Gene ID - Mouse ENSMUSG00000058240
Gene ID - Rat ENSRNOG00000028014
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CRYZL1 pAb (ATL-HPA029399 w/enhanced validation)
Datasheet Anti CRYZL1 pAb (ATL-HPA029399 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRYZL1 pAb (ATL-HPA029399 w/enhanced validation)