Anti CRYM pAb (ATL-HPA019086 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019086-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA019086 antibody. Corresponding CRYM RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: crystallin, mu
Gene Name: CRYM
Alternative Gene Name: DFNA40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030905: 90%, ENSRNOG00000061215: 88%
Entrez Gene ID: 1428
Uniprot ID: Q14894
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK
Gene Sequence DDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK
Gene ID - Mouse ENSMUSG00000030905
Gene ID - Rat ENSRNOG00000061215
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CRYM pAb (ATL-HPA019086 w/enhanced validation)
Datasheet Anti CRYM pAb (ATL-HPA019086 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRYM pAb (ATL-HPA019086 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CRYM pAb (ATL-HPA019086 w/enhanced validation)
Datasheet Anti CRYM pAb (ATL-HPA019086 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRYM pAb (ATL-HPA019086 w/enhanced validation)