Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA040403-25

• 
• 

Protein Description: crystallin, lambda 1
Gene Name: CRYL1
Alternative Gene Name: GDH, lambda-CRY, MGC149525, MGC149526
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021947: 83%, ENSRNOG00000008989: 81%
Entrez Gene ID: 51084
Uniprot ID: Q9Y2S2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLM
• Gene Sequence: IRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLM
• Gene ID - Mouse: ENSMUSG00000021947
• Gene ID - Rat: ENSRNOG00000008989
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation) – 1 Found

Garzón, Ingrid; Chato-Astrain, Jesus; González-Gallardo, Carmen; Ionescu, Ana; Cardona, Juan de la Cruz; Mateu, Miguel; Carda, Carmen; Pérez, María Del Mar; Martín-Piedra, Miguel Ángel; Alaminos, Miguel. Long-Term in vivo Evaluation of Orthotypical and Heterotypical Bioengineered Human Corneas. Frontiers In Bioengineering And Biotechnology. 8( 32671048):681.