Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040403-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CRYL1
Alternative Gene Name: GDH, lambda-CRY, MGC149525, MGC149526
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021947: 83%, ENSRNOG00000008989: 81%
Entrez Gene ID: 51084
Uniprot ID: Q9Y2S2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLM |
Gene Sequence | IRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLM |
Gene ID - Mouse | ENSMUSG00000021947 |
Gene ID - Rat | ENSRNOG00000008989 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation) | |
Datasheet | Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation) | |
Datasheet | Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation) |
Citations for Anti CRYL1 pAb (ATL-HPA040403 w/enhanced validation) – 1 Found |
Garzón, Ingrid; Chato-Astrain, Jesus; González-Gallardo, Carmen; Ionescu, Ana; Cardona, Juan de la Cruz; Mateu, Miguel; Carda, Carmen; Pérez, María Del Mar; Martín-Piedra, Miguel Ángel; Alaminos, Miguel. Long-Term in vivo Evaluation of Orthotypical and Heterotypical Bioengineered Human Corneas. Frontiers In Bioengineering And Biotechnology. 8( 32671048):681. PubMed |