Anti CRYGS pAb (ATL-HPA063539)

Atlas Antibodies

Catalog No.:
ATL-HPA063539-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: crystallin gamma S
Gene Name: CRYGS
Alternative Gene Name: CRYG8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033501: 86%, ENSRNOG00000038355: 83%
Entrez Gene ID: 1427
Uniprot ID: P22914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKV
Gene Sequence MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKV
Gene ID - Mouse ENSMUSG00000033501
Gene ID - Rat ENSRNOG00000038355
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRYGS pAb (ATL-HPA063539)
Datasheet Anti CRYGS pAb (ATL-HPA063539) Datasheet (External Link)
Vendor Page Anti CRYGS pAb (ATL-HPA063539) at Atlas Antibodies

Documents & Links for Anti CRYGS pAb (ATL-HPA063539)
Datasheet Anti CRYGS pAb (ATL-HPA063539) Datasheet (External Link)
Vendor Page Anti CRYGS pAb (ATL-HPA063539)