Anti CRYGA pAb (ATL-HPA043386)

Atlas Antibodies

Catalog No.:
ATL-HPA043386-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: crystallin gamma A
Gene Name: CRYGA
Alternative Gene Name: CRY-g-A, CRYG1, CRYG5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025952: 94%, ENSRNOG00000014950: 94%
Entrez Gene ID: 1418
Uniprot ID: P11844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CNSIRVDSGCWMLYERPNYQGHQYFLRRGKY
Gene Sequence CNSIRVDSGCWMLYERPNYQGHQYFLRRGKY
Gene ID - Mouse ENSMUSG00000025952
Gene ID - Rat ENSRNOG00000014950
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRYGA pAb (ATL-HPA043386)
Datasheet Anti CRYGA pAb (ATL-HPA043386) Datasheet (External Link)
Vendor Page Anti CRYGA pAb (ATL-HPA043386) at Atlas Antibodies

Documents & Links for Anti CRYGA pAb (ATL-HPA043386)
Datasheet Anti CRYGA pAb (ATL-HPA043386) Datasheet (External Link)
Vendor Page Anti CRYGA pAb (ATL-HPA043386)