Anti CRYGA pAb (ATL-HPA043386)

Atlas Antibodies

Catalog No.: ATL-HPA043386-25

Protein Description: crystallin gamma A
Gene Name: CRYGA
Alternative Gene Name: CRY-g-A, CRYG1, CRYG5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025952: 94%, ENSRNOG00000014950: 94%
Entrez Gene ID: 1418
Uniprot ID: P11844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CNSIRVDSGCWMLYERPNYQGHQYFLRRGKY
• Gene Sequence: CNSIRVDSGCWMLYERPNYQGHQYFLRRGKY
• Gene ID - Mouse: ENSMUSG00000025952
• Gene ID - Rat: ENSRNOG00000014950
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.