Anti CRYBB1 pAb (ATL-HPA003448)

Atlas Antibodies

Catalog No.:
ATL-HPA003448-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: crystallin beta B1
Gene Name: CRYBB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029343: 79%, ENSRNOG00000047653: 80%
Entrez Gene ID: 1414
Uniprot ID: P53674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQE
Gene Sequence TTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQE
Gene ID - Mouse ENSMUSG00000029343
Gene ID - Rat ENSRNOG00000047653
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRYBB1 pAb (ATL-HPA003448)
Datasheet Anti CRYBB1 pAb (ATL-HPA003448) Datasheet (External Link)
Vendor Page Anti CRYBB1 pAb (ATL-HPA003448) at Atlas Antibodies

Documents & Links for Anti CRYBB1 pAb (ATL-HPA003448)
Datasheet Anti CRYBB1 pAb (ATL-HPA003448) Datasheet (External Link)
Vendor Page Anti CRYBB1 pAb (ATL-HPA003448)