Anti CRYBA1 pAb (ATL-HPA022016)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022016-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CRYBA1
Alternative Gene Name: CRYB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000724: 91%, ENSRNOG00000008700: 91%
Entrez Gene ID: 1411
Uniprot ID: P05813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTSSCPNVSERSFDNVRSLKVES |
Gene Sequence | METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTSSCPNVSERSFDNVRSLKVES |
Gene ID - Mouse | ENSMUSG00000000724 |
Gene ID - Rat | ENSRNOG00000008700 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CRYBA1 pAb (ATL-HPA022016) | |
Datasheet | Anti CRYBA1 pAb (ATL-HPA022016) Datasheet (External Link) |
Vendor Page | Anti CRYBA1 pAb (ATL-HPA022016) at Atlas Antibodies |
Documents & Links for Anti CRYBA1 pAb (ATL-HPA022016) | |
Datasheet | Anti CRYBA1 pAb (ATL-HPA022016) Datasheet (External Link) |
Vendor Page | Anti CRYBA1 pAb (ATL-HPA022016) |