Anti CRYBA1 pAb (ATL-HPA022016)

Atlas Antibodies

Catalog No.:
ATL-HPA022016-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: crystallin beta A1
Gene Name: CRYBA1
Alternative Gene Name: CRYB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000724: 91%, ENSRNOG00000008700: 91%
Entrez Gene ID: 1411
Uniprot ID: P05813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTSSCPNVSERSFDNVRSLKVES
Gene Sequence METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTSSCPNVSERSFDNVRSLKVES
Gene ID - Mouse ENSMUSG00000000724
Gene ID - Rat ENSRNOG00000008700
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRYBA1 pAb (ATL-HPA022016)
Datasheet Anti CRYBA1 pAb (ATL-HPA022016) Datasheet (External Link)
Vendor Page Anti CRYBA1 pAb (ATL-HPA022016) at Atlas Antibodies

Documents & Links for Anti CRYBA1 pAb (ATL-HPA022016)
Datasheet Anti CRYBA1 pAb (ATL-HPA022016) Datasheet (External Link)
Vendor Page Anti CRYBA1 pAb (ATL-HPA022016)