Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA057100-25

Protein Description: crystallin, alpha B
Gene Name: CRYAB
Alternative Gene Name: CRYA2, HSPB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032060: 98%, ENSRNOG00000010524: 98%
Entrez Gene ID: 1410
Uniprot ID: P02511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA
• Gene Sequence: KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA
• Gene ID - Mouse: ENSMUSG00000032060
• Gene ID - Rat: ENSRNOG00000010524
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.