Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057100-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: CRYAB
Alternative Gene Name: CRYA2, HSPB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032060: 98%, ENSRNOG00000010524: 98%
Entrez Gene ID: 1410
Uniprot ID: P02511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA |
| Gene Sequence | KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA |
| Gene ID - Mouse | ENSMUSG00000032060 |
| Gene ID - Rat | ENSRNOG00000010524 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) | |
| Datasheet | Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) | |
| Datasheet | Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) |