Anti CRYAA pAb (ATL-HPA038430)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038430-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CRYAA
Alternative Gene Name: CRYA1, HSPB4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024041: 75%, ENSRNOG00000047175: 97%
Entrez Gene ID: 1409
Uniprot ID: P02489
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVE |
| Gene Sequence | PSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVE |
| Gene ID - Mouse | ENSMUSG00000024041 |
| Gene ID - Rat | ENSRNOG00000047175 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRYAA pAb (ATL-HPA038430) | |
| Datasheet | Anti CRYAA pAb (ATL-HPA038430) Datasheet (External Link) |
| Vendor Page | Anti CRYAA pAb (ATL-HPA038430) at Atlas Antibodies |
| Documents & Links for Anti CRYAA pAb (ATL-HPA038430) | |
| Datasheet | Anti CRYAA pAb (ATL-HPA038430) Datasheet (External Link) |
| Vendor Page | Anti CRYAA pAb (ATL-HPA038430) |
| Citations for Anti CRYAA pAb (ATL-HPA038430) – 1 Found |
| Degrugillier, Fanny; Aissat, Abdel; Prulière-Escabasse, Virginie; Bizard, Lucie; Simonneau, Benjamin; Decrouy, Xavier; Jiang, Chong; Rotin, Daniela; Fanen, Pascale; Simon, Stéphanie. Phosphorylation of the Chaperone-Like HspB5 Rescues Trafficking and Function of F508del-CFTR. International Journal Of Molecular Sciences. 2020;21(14) PubMed |