Anti CRYAA pAb (ATL-HPA038430)

Atlas Antibodies

Catalog No.:
ATL-HPA038430-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: crystallin alpha A
Gene Name: CRYAA
Alternative Gene Name: CRYA1, HSPB4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024041: 75%, ENSRNOG00000047175: 97%
Entrez Gene ID: 1409
Uniprot ID: P02489
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVE
Gene Sequence PSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVE
Gene ID - Mouse ENSMUSG00000024041
Gene ID - Rat ENSRNOG00000047175
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRYAA pAb (ATL-HPA038430)
Datasheet Anti CRYAA pAb (ATL-HPA038430) Datasheet (External Link)
Vendor Page Anti CRYAA pAb (ATL-HPA038430) at Atlas Antibodies

Documents & Links for Anti CRYAA pAb (ATL-HPA038430)
Datasheet Anti CRYAA pAb (ATL-HPA038430) Datasheet (External Link)
Vendor Page Anti CRYAA pAb (ATL-HPA038430)
Citations for Anti CRYAA pAb (ATL-HPA038430) – 1 Found
Degrugillier, Fanny; Aissat, Abdel; Prulière-Escabasse, Virginie; Bizard, Lucie; Simonneau, Benjamin; Decrouy, Xavier; Jiang, Chong; Rotin, Daniela; Fanen, Pascale; Simon, Stéphanie. Phosphorylation of the Chaperone-Like HspB5 Rescues Trafficking and Function of F508del-CFTR. International Journal Of Molecular Sciences. 2020;21(14)  PubMed