Anti CRYAA pAb (ATL-HPA037737)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037737-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CRYAA
Alternative Gene Name: CRYA1, HSPB4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024041: 92%, ENSRNOG00000047175: 92%
Entrez Gene ID: 1409
Uniprot ID: P02489
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSA |
Gene Sequence | KHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSA |
Gene ID - Mouse | ENSMUSG00000024041 |
Gene ID - Rat | ENSRNOG00000047175 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CRYAA pAb (ATL-HPA037737) | |
Datasheet | Anti CRYAA pAb (ATL-HPA037737) Datasheet (External Link) |
Vendor Page | Anti CRYAA pAb (ATL-HPA037737) at Atlas Antibodies |
Documents & Links for Anti CRYAA pAb (ATL-HPA037737) | |
Datasheet | Anti CRYAA pAb (ATL-HPA037737) Datasheet (External Link) |
Vendor Page | Anti CRYAA pAb (ATL-HPA037737) |