Anti CRY2 pAb (ATL-HPA037577)

Atlas Antibodies

SKU: ATL-HPA037577-25

• 
• 
• 

Protein Description: cryptochrome circadian clock 2
Gene Name: CRY2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068742: 83%, ENSRNOG00000007478: 82%
Entrez Gene ID: 1408
Uniprot ID: Q49AN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA
• Gene Sequence: LLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA
• Gene ID - Mouse: ENSMUSG00000068742
• Gene ID - Rat: ENSRNOG00000007478
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CRY2 pAb (ATL-HPA037577) – 1 Found

Kim, Boil; Kim, Jihoon; Chun, Minjeong; Park, Inah; Kwak, Damhyeon; Choi, Mijung; Kim, Kyungjin; Choe, Han Kyoung. Multiplexed CRISPR-Cas9 system in a single adeno-associated virus to simultaneously knock out redundant clock genes. Scientific Reports. 2021;11(1):2575.