Anti CRY2 pAb (ATL-HPA037577)

Atlas Antibodies

Catalog No.:
ATL-HPA037577-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cryptochrome circadian clock 2
Gene Name: CRY2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068742: 83%, ENSRNOG00000007478: 82%
Entrez Gene ID: 1408
Uniprot ID: Q49AN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA
Gene Sequence LLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA
Gene ID - Mouse ENSMUSG00000068742
Gene ID - Rat ENSRNOG00000007478
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRY2 pAb (ATL-HPA037577)
Datasheet Anti CRY2 pAb (ATL-HPA037577) Datasheet (External Link)
Vendor Page Anti CRY2 pAb (ATL-HPA037577) at Atlas Antibodies

Documents & Links for Anti CRY2 pAb (ATL-HPA037577)
Datasheet Anti CRY2 pAb (ATL-HPA037577) Datasheet (External Link)
Vendor Page Anti CRY2 pAb (ATL-HPA037577)
Citations for Anti CRY2 pAb (ATL-HPA037577) – 1 Found
Kim, Boil; Kim, Jihoon; Chun, Minjeong; Park, Inah; Kwak, Damhyeon; Choi, Mijung; Kim, Kyungjin; Choe, Han Kyoung. Multiplexed CRISPR-Cas9 system in a single adeno-associated virus to simultaneously knock out redundant clock genes. Scientific Reports. 2021;11(1):2575.  PubMed