Anti CRY2 pAb (ATL-HPA037577)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037577-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CRY2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068742: 83%, ENSRNOG00000007478: 82%
Entrez Gene ID: 1408
Uniprot ID: Q49AN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA |
| Gene Sequence | LLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA |
| Gene ID - Mouse | ENSMUSG00000068742 |
| Gene ID - Rat | ENSRNOG00000007478 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRY2 pAb (ATL-HPA037577) | |
| Datasheet | Anti CRY2 pAb (ATL-HPA037577) Datasheet (External Link) |
| Vendor Page | Anti CRY2 pAb (ATL-HPA037577) at Atlas Antibodies |
| Documents & Links for Anti CRY2 pAb (ATL-HPA037577) | |
| Datasheet | Anti CRY2 pAb (ATL-HPA037577) Datasheet (External Link) |
| Vendor Page | Anti CRY2 pAb (ATL-HPA037577) |
| Citations for Anti CRY2 pAb (ATL-HPA037577) – 1 Found |
| Kim, Boil; Kim, Jihoon; Chun, Minjeong; Park, Inah; Kwak, Damhyeon; Choi, Mijung; Kim, Kyungjin; Choe, Han Kyoung. Multiplexed CRISPR-Cas9 system in a single adeno-associated virus to simultaneously knock out redundant clock genes. Scientific Reports. 2021;11(1):2575. PubMed |