Anti CRX pAb (ATL-HPA036762 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA036762-25
  • Immunohistochemical staining of human cerebral cortex, colon, eye, retina and testis using Anti-CRX antibody HPA036762 (A) shows similar protein distribution across tissues to independent antibody HPA036763 (B).
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CRX over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424645).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cone-rod homeobox
Gene Name: CRX
Alternative Gene Name: CORD2, CRD, LCA7, OTX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041578: 97%, ENSRNOG00000013890: 96%
Entrez Gene ID: 1406
Uniprot ID: O43186
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFK
Gene Sequence PLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFK
Gene ID - Mouse ENSMUSG00000041578
Gene ID - Rat ENSRNOG00000013890
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CRX pAb (ATL-HPA036762 w/enhanced validation)
Datasheet Anti CRX pAb (ATL-HPA036762 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRX pAb (ATL-HPA036762 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CRX pAb (ATL-HPA036762 w/enhanced validation)
Datasheet Anti CRX pAb (ATL-HPA036762 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRX pAb (ATL-HPA036762 w/enhanced validation)



Citations for Anti CRX pAb (ATL-HPA036762 w/enhanced validation) – 1 Found
Pensieri, Pasquale; Mantilleri, Annabelle; Plassard, Damien; Furukawa, Takahisa; Moya, Kenneth L; Prochiantz, Alain; Lamonerie, Thomas. Photoreceptor cKO of OTX2 Enhances OTX2 Intercellular Transfer in the Retina and Causes Photophobia. Eneuro. 2021;8(5)  PubMed