Anti CRTC3 pAb (ATL-HPA063691)

Atlas Antibodies

SKU:
ATL-HPA063691-25
  • Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CREB regulated transcription coactivator 3
Gene Name: CRTC3
Alternative Gene Name: FLJ21868
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030527: 74%, ENSRNOG00000011975: 83%
Entrez Gene ID: 64784
Uniprot ID: Q6UUV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTS
Gene Sequence SSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTS
Gene ID - Mouse ENSMUSG00000030527
Gene ID - Rat ENSRNOG00000011975
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CRTC3 pAb (ATL-HPA063691)
Datasheet Anti CRTC3 pAb (ATL-HPA063691) Datasheet (External Link)
Vendor Page Anti CRTC3 pAb (ATL-HPA063691) at Atlas Antibodies

Documents & Links for Anti CRTC3 pAb (ATL-HPA063691)
Datasheet Anti CRTC3 pAb (ATL-HPA063691) Datasheet (External Link)
Vendor Page Anti CRTC3 pAb (ATL-HPA063691)