Anti CRTC3 pAb (ATL-HPA043735)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043735-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CRTC3
Alternative Gene Name: FLJ21868
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030527: 91%, ENSRNOG00000011975: 93%
Entrez Gene ID: 64784
Uniprot ID: Q6UUV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALN |
| Gene Sequence | HGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALN |
| Gene ID - Mouse | ENSMUSG00000030527 |
| Gene ID - Rat | ENSRNOG00000011975 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRTC3 pAb (ATL-HPA043735) | |
| Datasheet | Anti CRTC3 pAb (ATL-HPA043735) Datasheet (External Link) |
| Vendor Page | Anti CRTC3 pAb (ATL-HPA043735) at Atlas Antibodies |
| Documents & Links for Anti CRTC3 pAb (ATL-HPA043735) | |
| Datasheet | Anti CRTC3 pAb (ATL-HPA043735) Datasheet (External Link) |
| Vendor Page | Anti CRTC3 pAb (ATL-HPA043735) |