Anti CRTC2 pAb (ATL-HPA028465)

Atlas Antibodies

SKU:
ATL-HPA028465-25
  • Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in human cell line THP-1.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CREB regulated transcription coactivator 2
Gene Name: CRTC2
Alternative Gene Name: TORC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027936: 91%, ENSRNOG00000056337: 89%
Entrez Gene ID: 200186
Uniprot ID: Q53ET0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGL
Gene Sequence SPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGL
Gene ID - Mouse ENSMUSG00000027936
Gene ID - Rat ENSRNOG00000056337
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CRTC2 pAb (ATL-HPA028465)
Datasheet Anti CRTC2 pAb (ATL-HPA028465) Datasheet (External Link)
Vendor Page Anti CRTC2 pAb (ATL-HPA028465) at Atlas Antibodies

Documents & Links for Anti CRTC2 pAb (ATL-HPA028465)
Datasheet Anti CRTC2 pAb (ATL-HPA028465) Datasheet (External Link)
Vendor Page Anti CRTC2 pAb (ATL-HPA028465)