Anti CRTC2 pAb (ATL-HPA028454)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028454-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CRTC2
Alternative Gene Name: TORC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027936: 92%, ENSRNOG00000056337: 94%
Entrez Gene ID: 200186
Uniprot ID: Q53ET0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGIN |
| Gene Sequence | ALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGIN |
| Gene ID - Mouse | ENSMUSG00000027936 |
| Gene ID - Rat | ENSRNOG00000056337 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRTC2 pAb (ATL-HPA028454) | |
| Datasheet | Anti CRTC2 pAb (ATL-HPA028454) Datasheet (External Link) |
| Vendor Page | Anti CRTC2 pAb (ATL-HPA028454) at Atlas Antibodies |
| Documents & Links for Anti CRTC2 pAb (ATL-HPA028454) | |
| Datasheet | Anti CRTC2 pAb (ATL-HPA028454) Datasheet (External Link) |
| Vendor Page | Anti CRTC2 pAb (ATL-HPA028454) |