Anti CRTC2 pAb (ATL-HPA028454)

Atlas Antibodies

Catalog No.: ATL-HPA028454-25

Protein Description: CREB regulated transcription coactivator 2
Gene Name: CRTC2
Alternative Gene Name: TORC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027936: 92%, ENSRNOG00000056337: 94%
Entrez Gene ID: 200186
Uniprot ID: Q53ET0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGIN
• Gene Sequence: ALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGIN
• Gene ID - Mouse: ENSMUSG00000027936
• Gene ID - Rat: ENSRNOG00000056337
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.