Anti CRTC1 pAb (ATL-HPA063619)

Atlas Antibodies

Catalog No.: ATL-HPA063619-25

Protein Description: CREB regulated transcription coactivator 1
Gene Name: CRTC1
Alternative Gene Name: FLJ14027, KIAA0616, MECT1, TORC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003575: 81%, ENSRNOG00000022421: 76%
Entrez Gene ID: 23373
Uniprot ID: Q6UUV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARR
• Gene Sequence: PEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARR
• Gene ID - Mouse: ENSMUSG00000003575
• Gene ID - Rat: ENSRNOG00000022421
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.