Anti CRTC1 pAb (ATL-HPA063619)
Atlas Antibodies
- SKU:
- ATL-HPA063619-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CRTC1
Alternative Gene Name: FLJ14027, KIAA0616, MECT1, TORC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003575: 81%, ENSRNOG00000022421: 76%
Entrez Gene ID: 23373
Uniprot ID: Q6UUV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARR |
Gene Sequence | PEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARR |
Gene ID - Mouse | ENSMUSG00000003575 |
Gene ID - Rat | ENSRNOG00000022421 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CRTC1 pAb (ATL-HPA063619) | |
Datasheet | Anti CRTC1 pAb (ATL-HPA063619) Datasheet (External Link) |
Vendor Page | Anti CRTC1 pAb (ATL-HPA063619) at Atlas Antibodies |
Documents & Links for Anti CRTC1 pAb (ATL-HPA063619) | |
Datasheet | Anti CRTC1 pAb (ATL-HPA063619) Datasheet (External Link) |
Vendor Page | Anti CRTC1 pAb (ATL-HPA063619) |