Anti CRTC1 pAb (ATL-HPA022035)

Atlas Antibodies

Catalog No.:
ATL-HPA022035-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: CREB regulated transcription coactivator 1
Gene Name: CRTC1
Alternative Gene Name: FLJ14027, KIAA0616, MECT1, TORC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003575: 84%, ENSRNOG00000022421: 86%
Entrez Gene ID: 23373
Uniprot ID: Q6UUV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEV
Gene Sequence SPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEV
Gene ID - Mouse ENSMUSG00000003575
Gene ID - Rat ENSRNOG00000022421
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRTC1 pAb (ATL-HPA022035)
Datasheet Anti CRTC1 pAb (ATL-HPA022035) Datasheet (External Link)
Vendor Page Anti CRTC1 pAb (ATL-HPA022035) at Atlas Antibodies

Documents & Links for Anti CRTC1 pAb (ATL-HPA022035)
Datasheet Anti CRTC1 pAb (ATL-HPA022035) Datasheet (External Link)
Vendor Page Anti CRTC1 pAb (ATL-HPA022035)