Anti CRTAP pAb (ATL-HPA044150)

Atlas Antibodies

Catalog No.:
ATL-HPA044150-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: cartilage associated protein
Gene Name: CRTAP
Alternative Gene Name: CASP, LEPREL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032431: 91%, ENSRNOG00000009878: 89%
Entrez Gene ID: 10491
Uniprot ID: O75718
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEET
Gene Sequence LVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEET
Gene ID - Mouse ENSMUSG00000032431
Gene ID - Rat ENSRNOG00000009878
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRTAP pAb (ATL-HPA044150)
Datasheet Anti CRTAP pAb (ATL-HPA044150) Datasheet (External Link)
Vendor Page Anti CRTAP pAb (ATL-HPA044150) at Atlas Antibodies

Documents & Links for Anti CRTAP pAb (ATL-HPA044150)
Datasheet Anti CRTAP pAb (ATL-HPA044150) Datasheet (External Link)
Vendor Page Anti CRTAP pAb (ATL-HPA044150)