Anti CRTAP pAb (ATL-HPA043598)

Atlas Antibodies

Catalog No.:
ATL-HPA043598-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cartilage associated protein
Gene Name: CRTAP
Alternative Gene Name: CASP, LEPREL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032431: 92%, ENSRNOG00000009878: 91%
Entrez Gene ID: 10491
Uniprot ID: O75718
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLE
Gene Sequence RAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLE
Gene ID - Mouse ENSMUSG00000032431
Gene ID - Rat ENSRNOG00000009878
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRTAP pAb (ATL-HPA043598)
Datasheet Anti CRTAP pAb (ATL-HPA043598) Datasheet (External Link)
Vendor Page Anti CRTAP pAb (ATL-HPA043598) at Atlas Antibodies

Documents & Links for Anti CRTAP pAb (ATL-HPA043598)
Datasheet Anti CRTAP pAb (ATL-HPA043598) Datasheet (External Link)
Vendor Page Anti CRTAP pAb (ATL-HPA043598)