Anti CRP pAb (ATL-HPA027367 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA027367-25

• 
• 

Protein Description: C-reactive protein, pentraxin-related
Gene Name: CRP
Alternative Gene Name: PTX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037942: 69%, ENSRNOG00000000053: 57%
Entrez Gene ID: 1401
Uniprot ID: P02741
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGS
• Gene Sequence: MSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGS
• Gene ID - Mouse: ENSMUSG00000037942
• Gene ID - Rat: ENSRNOG00000000053
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.