Anti CROT pAb (ATL-HPA019364 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019364-100
  • Immunohistochemistry analysis in human thyroid gland and skeletal muscle tissues using Anti-CROT antibody. Corresponding CROT RNA-seq data are presented for the same tissues.
  • Western blot analysis using Anti-CROT antibody HPA019364 (A) shows similar pattern to independent antibody HPA019365 (B).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: carnitine O-octanoyltransferase
Gene Name: CROT
Alternative Gene Name: COT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003623: 78%, ENSRNOG00000006779: 79%
Entrez Gene ID: 54677
Uniprot ID: Q9UKG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNISYYVDEKIFQNEGRWKGSEKVRDIPLPEELIFIVDEKVLNDINQAKAQYLR
Gene Sequence VRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNISYYVDEKIFQNEGRWKGSEKVRDIPLPEELIFIVDEKVLNDINQAKAQYLR
Gene ID - Mouse ENSMUSG00000003623
Gene ID - Rat ENSRNOG00000006779
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CROT pAb (ATL-HPA019364 w/enhanced validation)
Datasheet Anti CROT pAb (ATL-HPA019364 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CROT pAb (ATL-HPA019364 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CROT pAb (ATL-HPA019364 w/enhanced validation)
Datasheet Anti CROT pAb (ATL-HPA019364 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CROT pAb (ATL-HPA019364 w/enhanced validation)



Citations for Anti CROT pAb (ATL-HPA019364 w/enhanced validation) – 1 Found
Sun, Chenglong; Wang, Fukai; Zhang, Yang; Yu, Jinqian; Wang, Xiao. Mass spectrometry imaging-based metabolomics to visualize the spatially resolved reprogramming of carnitine metabolism in breast cancer. Theranostics. 10(16):7070-7082.  PubMed