Anti CRNN pAb (ATL-HPA024343 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024343-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CRNN
Alternative Gene Name: C1orf10, SEP53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078657: 39%, ENSRNOG00000008721: 40%
Entrez Gene ID: 49860
Uniprot ID: Q9UBG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YDRQAESQSQERISPQIQLSGQTEQTQKAGEGKRNQTTEMRPERQPQTREQDRAHQTGETVTGSGTQTQAGATQTVEQDSSHQTGRTSKQTQEATNDQNR |
| Gene Sequence | YDRQAESQSQERISPQIQLSGQTEQTQKAGEGKRNQTTEMRPERQPQTREQDRAHQTGETVTGSGTQTQAGATQTVEQDSSHQTGRTSKQTQEATNDQNR |
| Gene ID - Mouse | ENSMUSG00000078657 |
| Gene ID - Rat | ENSRNOG00000008721 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRNN pAb (ATL-HPA024343 w/enhanced validation) | |
| Datasheet | Anti CRNN pAb (ATL-HPA024343 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRNN pAb (ATL-HPA024343 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CRNN pAb (ATL-HPA024343 w/enhanced validation) | |
| Datasheet | Anti CRNN pAb (ATL-HPA024343 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRNN pAb (ATL-HPA024343 w/enhanced validation) |
| Citations for Anti CRNN pAb (ATL-HPA024343 w/enhanced validation) – 2 Found |
| Karumuri, Rachna; Shah, Dean; Arnouk, Hilal. Cornulin as a Potential Novel Biomarker for Cutaneous Squamous Cell Carcinoma. Cureus. 2022;14(11):e31694. PubMed |
| Karumuri, Rachna; Shah, Dean; Arnouk, Hilal. Cornulin as a Prognosticator for Lymph Node Involvement in Cutaneous Squamous Cell Carcinoma. Cureus. 2022;14(12):e33130. PubMed |