Anti CRMP1 pAb (ATL-HPA035640 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035640-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CRMP1
Alternative Gene Name: DPYSL1, DRP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029121: 89%, ENSRNOG00000004781: 89%
Entrez Gene ID: 1400
Uniprot ID: Q14194
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVK |
Gene Sequence | QGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVK |
Gene ID - Mouse | ENSMUSG00000029121 |
Gene ID - Rat | ENSRNOG00000004781 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CRMP1 pAb (ATL-HPA035640 w/enhanced validation) | |
Datasheet | Anti CRMP1 pAb (ATL-HPA035640 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CRMP1 pAb (ATL-HPA035640 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CRMP1 pAb (ATL-HPA035640 w/enhanced validation) | |
Datasheet | Anti CRMP1 pAb (ATL-HPA035640 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CRMP1 pAb (ATL-HPA035640 w/enhanced validation) |
Citations for Anti CRMP1 pAb (ATL-HPA035640 w/enhanced validation) – 1 Found |
Boulan, Benoît; Ravanello, Charlotte; Peyrel, Amandine; Bosc, Christophe; Delphin, Christian; Appaix, Florence; Denarier, Eric; Kraut, Alexandra; Jacquier-Sarlin, Muriel; Fournier, Alyson; Andrieux, Annie; Gory-Fauré, Sylvie; Deloulme, Jean-Christophe. CRMP4-mediated fornix development involves Semaphorin-3E signaling pathway. Elife. 2021;10( 34860155) PubMed |