Anti CRMP1 pAb (ATL-HPA035640 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035640-25

Protein Description: collapsin response mediator protein 1
Gene Name: CRMP1
Alternative Gene Name: DPYSL1, DRP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029121: 89%, ENSRNOG00000004781: 89%
Entrez Gene ID: 1400
Uniprot ID: Q14194
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVK
• Gene Sequence: QGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVK
• Gene ID - Mouse: ENSMUSG00000029121
• Gene ID - Rat: ENSRNOG00000004781
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CRMP1 pAb (ATL-HPA035640 w/enhanced validation) – 1 Found

Boulan, Benoît; Ravanello, Charlotte; Peyrel, Amandine; Bosc, Christophe; Delphin, Christian; Appaix, Florence; Denarier, Eric; Kraut, Alexandra; Jacquier-Sarlin, Muriel; Fournier, Alyson; Andrieux, Annie; Gory-Fauré, Sylvie; Deloulme, Jean-Christophe. CRMP4-mediated fornix development involves Semaphorin-3E signaling pathway. Elife. 2021;10( 34860155)