Anti CRLF1 pAb (ATL-HPA041493)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041493-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CRLF1
Alternative Gene Name: CISS, CISS1, CLF, CLF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007888: 93%, ENSRNOG00000020030: 93%
Entrez Gene ID: 9244
Uniprot ID: O75462
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLP |
| Gene Sequence | HTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLP |
| Gene ID - Mouse | ENSMUSG00000007888 |
| Gene ID - Rat | ENSRNOG00000020030 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRLF1 pAb (ATL-HPA041493) | |
| Datasheet | Anti CRLF1 pAb (ATL-HPA041493) Datasheet (External Link) |
| Vendor Page | Anti CRLF1 pAb (ATL-HPA041493) at Atlas Antibodies |
| Documents & Links for Anti CRLF1 pAb (ATL-HPA041493) | |
| Datasheet | Anti CRLF1 pAb (ATL-HPA041493) Datasheet (External Link) |
| Vendor Page | Anti CRLF1 pAb (ATL-HPA041493) |
| Citations for Anti CRLF1 pAb (ATL-HPA041493) – 1 Found |
| Yu, Shi-Tong; Zhong, Qian; Chen, Ren-Hui; Han, Ping; Li, Shi-Bing; Zhang, Hua; Yuan, Li; Xia, Tian-Liang; Zeng, Mu-Sheng; Huang, Xiao-Ming. CRLF1 promotes malignant phenotypes of papillary thyroid carcinoma by activating the MAPK/ERK and PI3K/AKT pathways. Cell Death & Disease. 2018;9(3):371. PubMed |