Anti CRKL pAb (ATL-HPA001100)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001100-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CRKL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006134: 96%, ENSRNOG00000001868: 96%
Entrez Gene ID: 1399
Uniprot ID: P46109
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDE |
| Gene Sequence | LEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDE |
| Gene ID - Mouse | ENSMUSG00000006134 |
| Gene ID - Rat | ENSRNOG00000001868 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRKL pAb (ATL-HPA001100) | |
| Datasheet | Anti CRKL pAb (ATL-HPA001100) Datasheet (External Link) |
| Vendor Page | Anti CRKL pAb (ATL-HPA001100) at Atlas Antibodies |
| Documents & Links for Anti CRKL pAb (ATL-HPA001100) | |
| Datasheet | Anti CRKL pAb (ATL-HPA001100) Datasheet (External Link) |
| Vendor Page | Anti CRKL pAb (ATL-HPA001100) |
| Citations for Anti CRKL pAb (ATL-HPA001100) – 2 Found |
| Lozic, Mirela; Minarik, Luka; Racetin, Anita; Filipovic, Natalija; Saraga Babic, Mirna; Vukojevic, Katarina. CRKL, AIFM3, AIF, BCL2, and UBASH3A during Human Kidney Development. International Journal Of Molecular Sciences. 2021;22(17) PubMed |
| Weiss, Joshua M; Hunter, Miranda V; Cruz, Nelly M; Baggiolini, Arianna; Tagore, Mohita; Ma, Yilun; Misale, Sandra; Marasco, Michelangelo; Simon-Vermot, Theresa; Campbell, Nathaniel R; Newell, Felicity; Wilmott, James S; Johansson, Peter A; Thompson, John F; Long, Georgina V; Pearson, John V; Mann, Graham J; Scolyer, Richard A; Waddell, Nicola; Montal, Emily D; Huang, Ting-Hsiang; Jonsson, Philip; Donoghue, Mark T A; Harris, Christopher C; Taylor, Barry S; Xu, Tianhao; Chaligné, Ronan; Shliaha, Pavel V; Hendrickson, Ronald; Jungbluth, Achim A; Lezcano, Cecilia; Koche, Richard; Studer, Lorenz; Ariyan, Charlotte E; Solit, David B; Wolchok, Jedd D; Merghoub, Taha; Rosen, Neal; Hayward, Nicholas K; White, Richard M. Anatomic position determines oncogenic specificity in melanoma. Nature. 2022;604(7905):354-361. PubMed |