Anti CRK pAb (ATL-HPA068087)

Atlas Antibodies

Catalog No.:
ATL-HPA068087-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: v-crk avian sarcoma virus CT10 oncogene homolog
Gene Name: CRK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017776: 98%, ENSRNOG00000025792: 100%
Entrez Gene ID: 1398
Uniprot ID: P46108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPF
Gene Sequence DTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPF
Gene ID - Mouse ENSMUSG00000017776
Gene ID - Rat ENSRNOG00000025792
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRK pAb (ATL-HPA068087)
Datasheet Anti CRK pAb (ATL-HPA068087) Datasheet (External Link)
Vendor Page Anti CRK pAb (ATL-HPA068087) at Atlas Antibodies

Documents & Links for Anti CRK pAb (ATL-HPA068087)
Datasheet Anti CRK pAb (ATL-HPA068087) Datasheet (External Link)
Vendor Page Anti CRK pAb (ATL-HPA068087)