Anti CRK pAb (ATL-HPA068087)

Atlas Antibodies

Catalog No.: ATL-HPA068087-25

Protein Description: v-crk avian sarcoma virus CT10 oncogene homolog
Gene Name: CRK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017776: 98%, ENSRNOG00000025792: 100%
Entrez Gene ID: 1398
Uniprot ID: P46108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPF
• Gene Sequence: DTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPF
• Gene ID - Mouse: ENSMUSG00000017776
• Gene ID - Rat: ENSRNOG00000025792
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.