Anti CRK pAb (ATL-HPA068087)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068087-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CRK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017776: 98%, ENSRNOG00000025792: 100%
Entrez Gene ID: 1398
Uniprot ID: P46108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPF |
Gene Sequence | DTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPF |
Gene ID - Mouse | ENSMUSG00000017776 |
Gene ID - Rat | ENSRNOG00000025792 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CRK pAb (ATL-HPA068087) | |
Datasheet | Anti CRK pAb (ATL-HPA068087) Datasheet (External Link) |
Vendor Page | Anti CRK pAb (ATL-HPA068087) at Atlas Antibodies |
Documents & Links for Anti CRK pAb (ATL-HPA068087) | |
Datasheet | Anti CRK pAb (ATL-HPA068087) Datasheet (External Link) |
Vendor Page | Anti CRK pAb (ATL-HPA068087) |