Anti CRISPLD2 pAb (ATL-HPA030055)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030055-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CRISPLD2
Alternative Gene Name: DKFZP434B044, LCRISP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031825: 77%, ENSRNOG00000016752: 83%
Entrez Gene ID: 83716
Uniprot ID: Q9H0B8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLCYREETYTPKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKKTSAVNYMTQVVRCDTKMKDRCKGSTCNRYQCPAGCLNHKAKIFGSLFYESSS |
| Gene Sequence | VCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLCYREETYTPKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKKTSAVNYMTQVVRCDTKMKDRCKGSTCNRYQCPAGCLNHKAKIFGSLFYESSS |
| Gene ID - Mouse | ENSMUSG00000031825 |
| Gene ID - Rat | ENSRNOG00000016752 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRISPLD2 pAb (ATL-HPA030055) | |
| Datasheet | Anti CRISPLD2 pAb (ATL-HPA030055) Datasheet (External Link) |
| Vendor Page | Anti CRISPLD2 pAb (ATL-HPA030055) at Atlas Antibodies |
| Documents & Links for Anti CRISPLD2 pAb (ATL-HPA030055) | |
| Datasheet | Anti CRISPLD2 pAb (ATL-HPA030055) Datasheet (External Link) |
| Vendor Page | Anti CRISPLD2 pAb (ATL-HPA030055) |
| Citations for Anti CRISPLD2 pAb (ATL-HPA030055) – 2 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Yoo, Jung-Yoon; Shin, Heesung; Kim, Tae Hoon; Choi, Won-Seok; Ferguson, Susan D; Fazleabas, Asgerally T; Young, Steven L; Lessey, Bruce A; Ha, Un-Hwan; Jeong, Jae-Wook. CRISPLD2 is a target of progesterone receptor and its expression is decreased in women with endometriosis. Plos One. 9(6):e100481. PubMed |