Anti CRIPT pAb (ATL-HPA046080)

Atlas Antibodies

Catalog No.:
ATL-HPA046080-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cysteine-rich PDZ-binding protein
Gene Name: CRIPT
Alternative Gene Name: HSPC139
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024146: 99%, ENSRNOG00000015215: 99%
Entrez Gene ID: 9419
Uniprot ID: Q9P021
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGC
Gene Sequence CEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGC
Gene ID - Mouse ENSMUSG00000024146
Gene ID - Rat ENSRNOG00000015215
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRIPT pAb (ATL-HPA046080)
Datasheet Anti CRIPT pAb (ATL-HPA046080) Datasheet (External Link)
Vendor Page Anti CRIPT pAb (ATL-HPA046080) at Atlas Antibodies

Documents & Links for Anti CRIPT pAb (ATL-HPA046080)
Datasheet Anti CRIPT pAb (ATL-HPA046080) Datasheet (External Link)
Vendor Page Anti CRIPT pAb (ATL-HPA046080)