Anti CRIP3 pAb (ATL-HPA036198)

Atlas Antibodies

SKU: ATL-HPA036198-100

• 
• 
• 

Protein Description: cysteine-rich protein 3
Gene Name: CRIP3
Alternative Gene Name: bA480N24.2, TLP, TLP-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023968: 81%, ENSRNOG00000018613: 85%
Entrez Gene ID: 401262
Uniprot ID: Q6Q6R5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CYGALFGPRGVNIGGVGSYLYNPPTPSPGCTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGETSLCPGCGEPVYFAEKVMSLGRNWHRP
• Gene Sequence: CYGALFGPRGVNIGGVGSYLYNPPTPSPGCTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGETSLCPGCGEPVYFAEKVMSLGRNWHRP
• Gene ID - Mouse: ENSMUSG00000023968
• Gene ID - Rat: ENSRNOG00000018613
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.