Anti CRIP2 pAb (ATL-HPA042664 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042664-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CRIP2
Alternative Gene Name: CRP2, ESP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006356: 84%, ENSRNOG00000005041: 84%
Entrez Gene ID: 1397
Uniprot ID: P52943
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAE |
| Gene Sequence | GAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAE |
| Gene ID - Mouse | ENSMUSG00000006356 |
| Gene ID - Rat | ENSRNOG00000005041 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRIP2 pAb (ATL-HPA042664 w/enhanced validation) | |
| Datasheet | Anti CRIP2 pAb (ATL-HPA042664 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRIP2 pAb (ATL-HPA042664 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CRIP2 pAb (ATL-HPA042664 w/enhanced validation) | |
| Datasheet | Anti CRIP2 pAb (ATL-HPA042664 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRIP2 pAb (ATL-HPA042664 w/enhanced validation) |
| Citations for Anti CRIP2 pAb (ATL-HPA042664 w/enhanced validation) – 1 Found |
| Li, Amy; Ponten, Fredrik; dos Remedios, Cristobal G. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics. 2012;12(2):203-25. PubMed |