Anti CRIP2 pAb (ATL-HPA042664 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA042664-25

• 
• 

Protein Description: cysteine-rich protein 2
Gene Name: CRIP2
Alternative Gene Name: CRP2, ESP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006356: 84%, ENSRNOG00000005041: 84%
Entrez Gene ID: 1397
Uniprot ID: P52943
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAE
• Gene Sequence: GAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAE
• Gene ID - Mouse: ENSMUSG00000006356
• Gene ID - Rat: ENSRNOG00000005041
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CRIP2 pAb (ATL-HPA042664 w/enhanced validation) – 1 Found

Li, Amy; Ponten, Fredrik; dos Remedios, Cristobal G. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics. 2012;12(2):203-25.