Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA000556-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cysteine rich transmembrane BMP regulator 1 (chordin-like)
Gene Name: CRIM1
Alternative Gene Name: S52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024074: 88%, ENSRNOG00000004208: 88%
Entrez Gene ID: 51232
Uniprot ID: Q9NZV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLP
Gene Sequence LTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLP
Gene ID - Mouse ENSMUSG00000024074
Gene ID - Rat ENSRNOG00000004208
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation)
Datasheet Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation)
Datasheet Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation)
Citations for Anti CRIM1 pAb (ATL-HPA000556 w/enhanced validation) – 4 Found
Hudson, Bryan D; Hum, Nicholas R; Thomas, Cynthia B; Kohlgruber, Ayano; Sebastian, Aimy; Collette, Nicole M; Coleman, Matthew A; Christiansen, Blaine A; Loots, Gabriela G. SOST Inhibits Prostate Cancer Invasion. Plos One. 10(11):e0142058.  PubMed
Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81.  PubMed
Nyström, Jenny; Hultenby, Kjell; Ek, Sara; Sjölund, Jonas; Axelson, Håkan; Jirström, Karin; Saleem, Moin A; Nilsson, Kristina; Johansson, Martin E. CRIM1 is localized to the podocyte filtration slit diaphragm of the adult human kidney. Nephrology, Dialysis, Transplantation : Official Publication Of The European Dialysis And Transplant Association - European Renal Association. 2009;24(7):2038-44.  PubMed
Chiu, Han Sheng; York, J Philippe; Wilkinson, Lorine; Zhang, Pumin; Little, Melissa H; Pennisi, David J. Production of a mouse line with a conditional Crim1 mutant allele. Genesis (New York, N.y. : 2000). 2012;50(9):711-6.  PubMed