Anti CRHR2 pAb (ATL-HPA046683)

Atlas Antibodies

Catalog No.: ATL-HPA046683-25

Protein Description: corticotropin releasing hormone receptor 2
Gene Name: CRHR2
Alternative Gene Name: CRF-RB, CRF2, HM-CRF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003476: 92%, ENSRNOG00000011145: 92%
Entrez Gene ID: 1395
Uniprot ID: Q13324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYR
• Gene Sequence: PCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYR
• Gene ID - Mouse: ENSMUSG00000003476
• Gene ID - Rat: ENSRNOG00000011145
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.