Anti CRHR2 pAb (ATL-HPA046683)

Atlas Antibodies

Catalog No.:
ATL-HPA046683-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: corticotropin releasing hormone receptor 2
Gene Name: CRHR2
Alternative Gene Name: CRF-RB, CRF2, HM-CRF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003476: 92%, ENSRNOG00000011145: 92%
Entrez Gene ID: 1395
Uniprot ID: Q13324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYR
Gene Sequence PCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYR
Gene ID - Mouse ENSMUSG00000003476
Gene ID - Rat ENSRNOG00000011145
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRHR2 pAb (ATL-HPA046683)
Datasheet Anti CRHR2 pAb (ATL-HPA046683) Datasheet (External Link)
Vendor Page Anti CRHR2 pAb (ATL-HPA046683) at Atlas Antibodies

Documents & Links for Anti CRHR2 pAb (ATL-HPA046683)
Datasheet Anti CRHR2 pAb (ATL-HPA046683) Datasheet (External Link)
Vendor Page Anti CRHR2 pAb (ATL-HPA046683)