Anti CRHBP pAb (ATL-HPA046120)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046120-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CRHBP
Alternative Gene Name: CRF-BP, CRFBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021680: 84%, ENSRNOG00000017890: 81%
Entrez Gene ID: 1393
Uniprot ID: P24387
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE |
| Gene Sequence | TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE |
| Gene ID - Mouse | ENSMUSG00000021680 |
| Gene ID - Rat | ENSRNOG00000017890 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRHBP pAb (ATL-HPA046120) | |
| Datasheet | Anti CRHBP pAb (ATL-HPA046120) Datasheet (External Link) |
| Vendor Page | Anti CRHBP pAb (ATL-HPA046120) at Atlas Antibodies |
| Documents & Links for Anti CRHBP pAb (ATL-HPA046120) | |
| Datasheet | Anti CRHBP pAb (ATL-HPA046120) Datasheet (External Link) |
| Vendor Page | Anti CRHBP pAb (ATL-HPA046120) |