Anti CRHBP pAb (ATL-HPA046120)

Atlas Antibodies

Catalog No.:
ATL-HPA046120-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: corticotropin releasing hormone binding protein
Gene Name: CRHBP
Alternative Gene Name: CRF-BP, CRFBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021680: 84%, ENSRNOG00000017890: 81%
Entrez Gene ID: 1393
Uniprot ID: P24387
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE
Gene Sequence TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE
Gene ID - Mouse ENSMUSG00000021680
Gene ID - Rat ENSRNOG00000017890
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRHBP pAb (ATL-HPA046120)
Datasheet Anti CRHBP pAb (ATL-HPA046120) Datasheet (External Link)
Vendor Page Anti CRHBP pAb (ATL-HPA046120) at Atlas Antibodies

Documents & Links for Anti CRHBP pAb (ATL-HPA046120)
Datasheet Anti CRHBP pAb (ATL-HPA046120) Datasheet (External Link)
Vendor Page Anti CRHBP pAb (ATL-HPA046120)