Anti CREM pAb (ATL-HPA001818 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA001818-25
  • Immunohistochemistry analysis in human testis and cerebral cortex tissues using Anti-CREM antibody. Corresponding CREM RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell lines PC-3 and Caco-2 using Anti-CREM antibody. Corresponding CREM RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cAMP responsive element modulator
Gene Name: CREM
Alternative Gene Name: hCREM-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063889: 84%, ENSRNOG00000014900: 71%
Entrez Gene ID: 1390
Uniprot ID: Q03060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC, ChIP-Exo-Seq
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen QHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSD
Gene Sequence QHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSD
Gene ID - Mouse ENSMUSG00000063889
Gene ID - Rat ENSRNOG00000014900
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CREM pAb (ATL-HPA001818 w/enhanced validation)
Datasheet Anti CREM pAb (ATL-HPA001818 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CREM pAb (ATL-HPA001818 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CREM pAb (ATL-HPA001818 w/enhanced validation)
Datasheet Anti CREM pAb (ATL-HPA001818 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CREM pAb (ATL-HPA001818 w/enhanced validation)