Anti CRELD2 pAb (ATL-HPA000603)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000603-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CRELD2
Alternative Gene Name: MGC11256
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023272: 78%, ENSRNOG00000004659: 79%
Entrez Gene ID: 79174
Uniprot ID: Q6UXH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVG |
Gene Sequence | HLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVG |
Gene ID - Mouse | ENSMUSG00000023272 |
Gene ID - Rat | ENSRNOG00000004659 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CRELD2 pAb (ATL-HPA000603) | |
Datasheet | Anti CRELD2 pAb (ATL-HPA000603) Datasheet (External Link) |
Vendor Page | Anti CRELD2 pAb (ATL-HPA000603) at Atlas Antibodies |
Documents & Links for Anti CRELD2 pAb (ATL-HPA000603) | |
Datasheet | Anti CRELD2 pAb (ATL-HPA000603) Datasheet (External Link) |
Vendor Page | Anti CRELD2 pAb (ATL-HPA000603) |
Citations for Anti CRELD2 pAb (ATL-HPA000603) – 1 Found |
Duxfield, Adam; Munkley, Jennifer; Briggs, Michael D; Dennis, Ella P. CRELD2 is a novel modulator of calcium release and calcineurin-NFAT signalling during osteoclast differentiation. Scientific Reports. 2022;12(1):13884. PubMed |