Anti CRELD2 pAb (ATL-HPA000603)

Atlas Antibodies

Catalog No.:
ATL-HPA000603-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cysteine-rich with EGF-like domains 2
Gene Name: CRELD2
Alternative Gene Name: MGC11256
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023272: 78%, ENSRNOG00000004659: 79%
Entrez Gene ID: 79174
Uniprot ID: Q6UXH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVG
Gene Sequence HLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVG
Gene ID - Mouse ENSMUSG00000023272
Gene ID - Rat ENSRNOG00000004659
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRELD2 pAb (ATL-HPA000603)
Datasheet Anti CRELD2 pAb (ATL-HPA000603) Datasheet (External Link)
Vendor Page Anti CRELD2 pAb (ATL-HPA000603) at Atlas Antibodies

Documents & Links for Anti CRELD2 pAb (ATL-HPA000603)
Datasheet Anti CRELD2 pAb (ATL-HPA000603) Datasheet (External Link)
Vendor Page Anti CRELD2 pAb (ATL-HPA000603)
Citations for Anti CRELD2 pAb (ATL-HPA000603) – 1 Found
Duxfield, Adam; Munkley, Jennifer; Briggs, Michael D; Dennis, Ella P. CRELD2 is a novel modulator of calcium release and calcineurin-NFAT signalling during osteoclast differentiation. Scientific Reports. 2022;12(1):13884.  PubMed