Anti CRELD2 pAb (ATL-HPA000603)

Atlas Antibodies

SKU: ATL-HPA000603-25

• 

Protein Description: cysteine-rich with EGF-like domains 2
Gene Name: CRELD2
Alternative Gene Name: MGC11256
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023272: 78%, ENSRNOG00000004659: 79%
Entrez Gene ID: 79174
Uniprot ID: Q6UXH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVG
• Gene Sequence: HLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVG
• Gene ID - Mouse: ENSMUSG00000023272
• Gene ID - Rat: ENSRNOG00000004659
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CRELD2 pAb (ATL-HPA000603) – 1 Found

Duxfield, Adam; Munkley, Jennifer; Briggs, Michael D; Dennis, Ella P. CRELD2 is a novel modulator of calcium release and calcineurin-NFAT signalling during osteoclast differentiation. Scientific Reports. 2022;12(1):13884.