Anti CREG1 pAb (ATL-HPA056390)

Atlas Antibodies

Catalog No.: ATL-HPA056390-25

Protein Description: cellular repressor of E1A-stimulated genes 1
Gene Name: CREG1
Alternative Gene Name: CREG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040713: 78%, ENSRNOG00000003291: 76%
Entrez Gene ID: 8804
Uniprot ID: O75629
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWLLD
• Gene Sequence: YATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWLLD
• Gene ID - Mouse: ENSMUSG00000040713
• Gene ID - Rat: ENSRNOG00000003291
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.