Anti CREG1 pAb (ATL-HPA056390)

Atlas Antibodies

Catalog No.:
ATL-HPA056390-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cellular repressor of E1A-stimulated genes 1
Gene Name: CREG1
Alternative Gene Name: CREG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040713: 78%, ENSRNOG00000003291: 76%
Entrez Gene ID: 8804
Uniprot ID: O75629
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWLLD
Gene Sequence YATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWLLD
Gene ID - Mouse ENSMUSG00000040713
Gene ID - Rat ENSRNOG00000003291
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CREG1 pAb (ATL-HPA056390)
Datasheet Anti CREG1 pAb (ATL-HPA056390) Datasheet (External Link)
Vendor Page Anti CREG1 pAb (ATL-HPA056390) at Atlas Antibodies

Documents & Links for Anti CREG1 pAb (ATL-HPA056390)
Datasheet Anti CREG1 pAb (ATL-HPA056390) Datasheet (External Link)
Vendor Page Anti CREG1 pAb (ATL-HPA056390)