Anti CREBBP pAb (ATL-HPA055861 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA055861-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: CREB binding protein
Gene Name: CREBBP
Alternative Gene Name: CBP, KAT3A, RSTS, RTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022521: 82%, ENSRNOG00000005330: 84%
Entrez Gene ID: 1387
Uniprot ID: Q92793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE
Gene Sequence VASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE
Gene ID - Mouse ENSMUSG00000022521
Gene ID - Rat ENSRNOG00000005330
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CREBBP pAb (ATL-HPA055861 w/enhanced validation)
Datasheet Anti CREBBP pAb (ATL-HPA055861 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CREBBP pAb (ATL-HPA055861 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CREBBP pAb (ATL-HPA055861 w/enhanced validation)
Datasheet Anti CREBBP pAb (ATL-HPA055861 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CREBBP pAb (ATL-HPA055861 w/enhanced validation)