Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024069-25

Protein Description: cAMP responsive element binding protein 3-like 1
Gene Name: CREB3L1
Alternative Gene Name: OASIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027230: 94%, ENSRNOG00000005413: 95%
Entrez Gene ID: 90993
Uniprot ID: Q96BA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQE
• Gene Sequence: LNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQE
• Gene ID - Mouse: ENSMUSG00000027230
• Gene ID - Rat: ENSRNOG00000005413
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) – 2 Found

Feng, Yu-Xiong; Jin, Dexter X; Sokol, Ethan S; Reinhardt, Ferenc; Miller, Daniel H; Gupta, Piyush B. Cancer-specific PERK signaling drives invasion and metastasis through CREB3L1. Nature Communications. 2017;8(1):1079. 

Greenwood, Mingkwan; Paterson, Alex; Rahman, Parveen Akhter; Gillard, Benjamin Thomas; Langley, Sydney; Iwasaki, Yasumasa; Murphy, David; Greenwood, Michael Paul. Transcription factor Creb3l1 regulates the synthesis of prohormone convertase enzyme PC1/3 in endocrine cells. Journal Of Neuroendocrinology. 2020;32(4):e12851.