Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024069-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CREB3L1
Alternative Gene Name: OASIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027230: 94%, ENSRNOG00000005413: 95%
Entrez Gene ID: 90993
Uniprot ID: Q96BA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQE |
Gene Sequence | LNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQE |
Gene ID - Mouse | ENSMUSG00000027230 |
Gene ID - Rat | ENSRNOG00000005413 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) | |
Datasheet | Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) | |
Datasheet | Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) |
Citations for Anti CREB3L1 pAb (ATL-HPA024069 w/enhanced validation) – 2 Found |
Feng, Yu-Xiong; Jin, Dexter X; Sokol, Ethan S; Reinhardt, Ferenc; Miller, Daniel H; Gupta, Piyush B. Cancer-specific PERK signaling drives invasion and metastasis through CREB3L1. Nature Communications. 2017;8(1):1079. PubMed |
Greenwood, Mingkwan; Paterson, Alex; Rahman, Parveen Akhter; Gillard, Benjamin Thomas; Langley, Sydney; Iwasaki, Yasumasa; Murphy, David; Greenwood, Michael Paul. Transcription factor Creb3l1 regulates the synthesis of prohormone convertase enzyme PC1/3 in endocrine cells. Journal Of Neuroendocrinology. 2020;32(4):e12851. PubMed |