Anti CREB3 pAb (ATL-HPA030978)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030978-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CREB3
Alternative Gene Name: Luman, LZIP, sLZIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028466: 93%, ENSRNOG00000016452: 91%
Entrez Gene ID: 10488
Uniprot ID: O43889
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS |
Gene Sequence | VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS |
Gene ID - Mouse | ENSMUSG00000028466 |
Gene ID - Rat | ENSRNOG00000016452 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CREB3 pAb (ATL-HPA030978) | |
Datasheet | Anti CREB3 pAb (ATL-HPA030978) Datasheet (External Link) |
Vendor Page | Anti CREB3 pAb (ATL-HPA030978) at Atlas Antibodies |
Documents & Links for Anti CREB3 pAb (ATL-HPA030978) | |
Datasheet | Anti CREB3 pAb (ATL-HPA030978) Datasheet (External Link) |
Vendor Page | Anti CREB3 pAb (ATL-HPA030978) |