Anti CREB3 pAb (ATL-HPA030978)

Atlas Antibodies

SKU: ATL-HPA030978-25

• 
• 

Protein Description: cAMP responsive element binding protein 3
Gene Name: CREB3
Alternative Gene Name: Luman, LZIP, sLZIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028466: 93%, ENSRNOG00000016452: 91%
Entrez Gene ID: 10488
Uniprot ID: O43889
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS
• Gene Sequence: VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS
• Gene ID - Mouse: ENSMUSG00000028466
• Gene ID - Rat: ENSRNOG00000016452
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.