Anti CREB3 pAb (ATL-HPA030978)

Atlas Antibodies

Catalog No.:
ATL-HPA030978-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cAMP responsive element binding protein 3
Gene Name: CREB3
Alternative Gene Name: Luman, LZIP, sLZIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028466: 93%, ENSRNOG00000016452: 91%
Entrez Gene ID: 10488
Uniprot ID: O43889
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS
Gene Sequence VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS
Gene ID - Mouse ENSMUSG00000028466
Gene ID - Rat ENSRNOG00000016452
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CREB3 pAb (ATL-HPA030978)
Datasheet Anti CREB3 pAb (ATL-HPA030978) Datasheet (External Link)
Vendor Page Anti CREB3 pAb (ATL-HPA030978) at Atlas Antibodies

Documents & Links for Anti CREB3 pAb (ATL-HPA030978)
Datasheet Anti CREB3 pAb (ATL-HPA030978) Datasheet (External Link)
Vendor Page Anti CREB3 pAb (ATL-HPA030978)