Anti CREB3 pAb (ATL-HPA030978)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030978-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CREB3
Alternative Gene Name: Luman, LZIP, sLZIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028466: 93%, ENSRNOG00000016452: 91%
Entrez Gene ID: 10488
Uniprot ID: O43889
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS |
| Gene Sequence | VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS |
| Gene ID - Mouse | ENSMUSG00000028466 |
| Gene ID - Rat | ENSRNOG00000016452 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CREB3 pAb (ATL-HPA030978) | |
| Datasheet | Anti CREB3 pAb (ATL-HPA030978) Datasheet (External Link) |
| Vendor Page | Anti CREB3 pAb (ATL-HPA030978) at Atlas Antibodies |
| Documents & Links for Anti CREB3 pAb (ATL-HPA030978) | |
| Datasheet | Anti CREB3 pAb (ATL-HPA030978) Datasheet (External Link) |
| Vendor Page | Anti CREB3 pAb (ATL-HPA030978) |